PDB entry 4oe5

View 4oe5 on RCSB PDB site
Description: Structure of Human ALDH4A1 Crystallized in Space Group P21
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, aldh4a1, rossmann fold, oxidoreductase, nad, mitochondria
Deposited on 2014-01-11, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH4, ALDH4A1, P5CDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oe5a_
  • Chain 'B':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH4, ALDH4A1, P5CDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oe5b_
  • Chain 'C':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH4, ALDH4A1, P5CDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oe5c_
  • Chain 'D':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH4, ALDH4A1, P5CDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oe5d_
  • Heterogens: 1PE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oe5A (A:)
    gshtgaglrwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevw
    tsdvqyqvspfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadm
    lsgprraeilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstns
    tvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreagl
    ppniiqfvpadgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlage
    cggknfhfvhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsr
    ikvgdpaedfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciv
    eskdpqepimkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeat
    kvlrnaagnfyindkstgsivgqqpfggarasgtndkpggphyilrwtspqvikethkpl
    gdwsyaymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oe5A (A:)
    rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
    spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
    ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvstnstvyrglegfv
    aaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfvpa
    dgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhfvh
    rsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsrikvgdpaedf
    gtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqepim
    keeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaagnf
    yindkstgshyilrwtspqviketh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oe5B (B:)
    gshtgaglrwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevw
    tsdvqyqvspfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadm
    lsgprraeilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstns
    tvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreagl
    ppniiqfvpadgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlage
    cggknfhfvhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsr
    ikvgdpaedfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciv
    eskdpqepimkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeat
    kvlrnaagnfyindkstgsivgqqpfggarasgtndkpggphyilrwtspqvikethkpl
    gdwsyaymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oe5B (B:)
    rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
    spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
    ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
    fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
    padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
    vhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsrikvgdpae
    dfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqep
    imkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaag
    nfyindkstgsigarasgtndkpggphyilrwtspqviketh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4oe5C (C:)
    gshtgaglrwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevw
    tsdvqyqvspfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadm
    lsgprraeilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstns
    tvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreagl
    ppniiqfvpadgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlage
    cggknfhfvhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsr
    ikvgdpaedfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciv
    eskdpqepimkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeat
    kvlrnaagnfyindkstgsivgqqpfggarasgtndkpggphyilrwtspqvikethkpl
    gdwsyaymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oe5C (C:)
    rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
    spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
    ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
    fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
    padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
    vhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsrikvgdpae
    dfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqep
    imkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaag
    nfyindkstgsarasgtndkpggphyilrwtspqviketh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4oe5D (D:)
    gshtgaglrwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevw
    tsdvqyqvspfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadm
    lsgprraeilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstns
    tvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreagl
    ppniiqfvpadgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlage
    cggknfhfvhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsr
    ikvgdpaedfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciv
    eskdpqepimkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeat
    kvlrnaagnfyindkstgsivgqqpfggarasgtndkpggphyilrwtspqvikethkpl
    gdwsyaymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oe5D (D:)
    rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
    spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
    ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
    fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
    padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
    vhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsrikvgdpae
    dfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqep
    imkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaag
    nfyindkstgshyilrwtspqviketh