PDB entry 4odv

View 4odv on RCSB PDB site
Description: Fab Structure of lipid A-specific antibody A6 in complex with lipid A carbohydrate backbone
Class: immune system
Keywords: Carbohydrate binding, IMMUNE SYSTEM
Deposited on 2014-01-10, released 2015-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: A6 Fab (IgG2b) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ODV (0-221)
  • Chain 'L':
    Compound: A6 Fab (IgG2b kappa) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ODV (0-End)
    Domains in SCOPe 2.06: d4odvl1, d4odvl2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4odvL (L:)
    divltqstsslsaslgdrvtitcrasqdirnylswyqqrpdgtvklliyytsklhsgvps
    rfsgsgsgtdysltitnleqediatyfcqqgktlplytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4odvL (L:)
    divltqstsslsaslgdrvtitcrasqdirnylswyqqrpdgtvklliyytsklhsgvps
    rfsgsgsgtdysltitnleqediatyfcqqgktlplytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne