PDB entry 4odt

View 4odt on RCSB PDB site
Description: Fab Structure of lipid A-specific antibody S1-15 in complex with lipid A carbohydrate backbone
Class: immune system
Keywords: Carbohydrate binding, IMMUNE SYSTEM
Deposited on 2014-01-10, released 2015-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: S1-15 Fab (IgG2b) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ODT (0-225)
  • Chain 'L':
    Compound: S1-15 Fab (IgG2b kappa) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ODT (0-213)
    Domains in SCOPe 2.06: d4odtl1, d4odtl2
  • Heterogens: PG0, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4odtL (L:)
    diqmtqstsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvkvliyytsrlrsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec