PDB entry 4odc

View 4odc on RCSB PDB site
Description: Crystal structure of Trematomus bernacchii hemoglobin in a partially cyanided state
Class: oxygen transport/protein binding
Keywords: alpha protein, Globin fold, oxygen transport, OXYGEN TRANSPORT-PROTEIN BINDING complex
Deposited on 2014-01-10, released 2014-12-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4odca_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4odcb_
  • Heterogens: CYN, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4odcA (A:)
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4odcB (B:)
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh