PDB entry 4od3

View 4od3 on RCSB PDB site
Description: Crystal structure of human Fab CAP256-VRC26.07, a potent V1V2-directed HIV-1 neutralizing antibody
Class: immune system
Keywords: Fab, HIV-1, V1V2, CAP256, VRC26, IMMUNE SYSTEM
Deposited on 2014-01-09, released 2014-02-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.222
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CAP256-VRC26.07 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OD3
  • Chain 'L':
    Compound: CAP256-VRC26.07 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OD3
    Domains in SCOPe 2.03: d4od3l1, d4od3l2
  • Heterogens: ZN, MES, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4od3L (L:)
    qavltqppsvsaapgqnvtiscsgsgsnignnfvswyqqrpgtapklliyesnkrpsgip
    drfsgsksgtsatlaitglqtgdeayyycatwaarlnsarvfgtgtmvtvlgqpkanptv
    tlyppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4od3L (L:)
    avltqppsvsaapgqnvtiscsgsgsnignnfvswyqqrpgtapklliyesnkrpsgipd
    rfsgsksgtsatlaitglqtgdeayyycatwaarlnsarvfgtgtmvtvlgqpkanptvt
    lyppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt