PDB entry 4ocy

View 4ocy on RCSB PDB site
Description: Fab for methotrexate (unbound apo)
Class: immune system
Keywords: IgG1/K family, IMMUNE SYSTEM
Deposited on 2014-01-09, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab ADD058 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OCY (0-215)
  • Chain 'L':
    Compound: Fab ADD058 Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OCY (0-215)
    Domains in SCOPe 2.07: d4ocyl1, d4ocyl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ocyL (L:)
    dvlltqiplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvstrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtqlelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr