PDB entry 4ocl

View 4ocl on RCSB PDB site
Description: Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ia
Class: hydrolase, protein binding
Keywords: 26S proteasome, isopeptidase activity, regulatory particle, lid, ubiquitin, HYDROLASE, PROTEIN BINDING
Deposited on 2014-01-09, released 2014-01-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26s proteasome regulatory subunit rpn8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: O5360, RPN8, YOR261C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 26s proteasome regulatory subunit rpn11
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MPR1, RPN11, YFR004W
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nb1
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OCL
    Domains in SCOPe 2.03: d4oclc_
  • Chain 'D':
    Compound: 26s proteasome regulatory subunit rpn8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: O5360, RPN8, YOR261C
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 26s proteasome regulatory subunit rpn11
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MPR1, RPN11, YFR004W
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Nb1
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OCL
    Domains in SCOPe 2.03: d4oclf_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4oclC (C:)
mqvqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggnty
yadsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvt
vsshhhhhhepea

    Sequence, based on observed residues (ATOM records): (download) 
    >4oclC (C:)
vqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyya
dsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
shhhh

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >4oclF (F:)
mqvqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggnty
yadsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvt
vsshhhhhhepea

    Sequence, based on observed residues (ATOM records): (download) 
    >4oclF (F:)
vqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyya
dsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
shhhh