PDB entry 4oci

View 4oci on RCSB PDB site
Description: Crystal Structure of Calcium Binding Protein-5 from Entamoeba histolytica and its involvement in initiation of phagocytosis of human erythrocytes
Class: signaling protein
Keywords: EF-hand, Signalling, SIGNALING PROTEIN
Deposited on 2014-01-09, released 2014-12-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.181
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin, putative
    Species: Entamoeba histolytica [TaxId:885318]
    Gene: CaBP5, EHI7A_088180
    Database cross-references and differences (RAF-indexed):
    • Uniprot N9UIU7 (Start-137)
      • expression tag (138-145)
    Domains in SCOPe 2.06: d4ocia1, d4ocia2
  • Heterogens: CA, NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ociA (A:)
    mqkhnedlkesfllfdgdgdgyltlnefeslvrvlgvvmetsaiastynsnskvrgmsye
    lftscfsqlktksfnkdeiktainvldkdkkgfipaielrrilstigdnmeqkeitdlft
    fmgideqgvvkvddfinqdnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ociA (A:)
    lkesfllfdgdgdgyltlnefeslvrvlgvvmetsaiastynsnskvrgmsyelftscfs
    qlktksfnkdeiktainvldkdkkgfipaielrrilstigdnmeqkeitdlftfmgideq
    gvvkvddfinqdnhhhhhh