PDB entry 4oaw

View 4oaw on RCSB PDB site
Description: Fab structure of anti-HIV gp120 V2 mAb 2158
Class: immune system
Keywords: Ig, antibody, HIV-1 gp120, IMMUNE SYSTEM
Deposited on 2014-01-06, released 2014-03-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.186
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OAW (0-213)
  • Chain 'B':
    Compound: Heavy chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OAW (0-235)
  • Chain 'C':
    Compound: Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OAW (0-213)
    Domains in SCOPe 2.04: d4oawc1, d4oawc2
  • Chain 'D':
    Compound: Heavy chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OAW (0-235)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oawC (C:)
    diqmtqspstlsasvgdrvtitcrasqtisswlawyqqksgtapklliykassivsgvps
    rfsgsgsgteftltitslqpddfatyycqqynsspetfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    No sequence available.