PDB entry 4o8x

View 4o8x on RCSB PDB site
Description: Zinc-bound Rpn11 in complex with Rpn8
Class: hydrolase
Keywords: MPN, JAMM, deubiquitinase, HYDROLASE
Deposited on 2013-12-30, released 2014-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26s proteasome regulatory subunit rpn8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: RPN8, YOR261C, O5360
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08723 (2-178)
      • expression tag (179-182)
    Domains in SCOPe 2.07: d4o8xa1, d4o8xa2
  • Chain 'B':
    Compound: 26s proteasome regulatory subunit rpn11
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: RPN11, MPR1, YFR004W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4o8xb_
  • Heterogens: EDO, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o8xA (A:)
    mgslqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeed
    eknsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnpl
    llivdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrdvl
    evlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8xA (A:)
    slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek
    nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll
    ivdvkqqgvglptdayvaieqtektflhlpctieaeeaeeigvehllrdvlevl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o8xB (B:)
    gperlqrlmmnskvgsadtgrddtketvyissiallkmlkhgragvpmevmglmlgefvd
    dytvnvvdvfampqsgtgvsveavddvfqakmmdmlkqtgrdqmvvgwyhshpgfgcwls
    svdvntqksfeqlnsravavvvdpiqsvkgkvvidafrlidtgalinnleprqttsntgl
    lnkaniqalihglnrhyyslnidyhktaketkmlmnlhkeqwqsglkmydyeekeesnla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8xB (B:)
    ketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsgtgvsveav
    ddvfqakmmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvdp
    iqsvkgkvvidafrlidlnrhyyslnidyhktaketkmlmnlhkeq