PDB entry 4o6r

View 4o6r on RCSB PDB site
Description: Crystal Structure of a Putative Aldehyde Dehydrogenase from Burkholderia cenocepacia
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE
Deposited on 2013-12-23, released 2014-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0469
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EJX1 (8-495)
      • expression tag (7)
    Domains in SCOPe 2.07: d4o6ra1, d4o6ra2
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0469
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EJX1 (8-495)
      • expression tag (7)
    Domains in SCOPe 2.07: d4o6rb1, d4o6rb2
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0469
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EJX1 (8-495)
      • expression tag (7)
    Domains in SCOPe 2.07: d4o6rc1, d4o6rc2
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0469
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EJX1 (8-495)
      • expression tag (7)
    Domains in SCOPe 2.07: d4o6rd1, d4o6rd2
  • Heterogens: AMP, NO3, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o6rA (A:)
    mahhhhhhmqtqlfidgrfvdavdrgtidvlnphdgsvitkiaaataadvdlavdaatra
    fpawsampaaergrlllrladaieantealaqlesldtghpirdsraldvprtaacfryf
    ggmadklqgsvipvdtgflnyvqrapigvvgqivpwnfplmftswkmgpalaagntvvlk
    pseitplstlrivelmaevgfpagvvnivpgyghtagqrlaehpgvgkiaftgstatgrr
    iveasqgnlkrvqlelggkganivfddanldaaingaawaifhnqgqaciagsrlvlher
    iadaflerfvalassirignpldpntemgpltskqhldrvlsyvdvareqggrvltggsa
    pqdpalangyyvrptiveakhatdrvaqeevfgpfvtvlrfgsddealaianateyglgs
    glwtndlsrahrmaaridagmcwincykrvnpgspfggvgksgygremgfeamhdytear
    svwvnvdgnvpphfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o6rA (A:)
    hmqtqlfidgrfvdavdrgtidvlnphdgsvitkiaaataadvdlavdaatrafpawsam
    paaergrlllrladaieantealaqlesldtghpirdsraldvprtaacfryfggmadkl
    qgsvipvdtgflnyvqrapigvvgqivpwnfplmftswkmgpalaagntvvlkpseitpl
    stlrivelmaevgfpagvvnivpgyghtagqrlaehpgvgkiaftgstatgrriveasqg
    nlkrvqlelggkganivfddanldaaingaawaifhnqgqaciagsrlvlheriadafle
    rfvalassirignpldpntemgpltskqhldrvlsyvdvareqggrvltggsapqdpala
    ngyyvrptiveakhatdrvaqeevfgpfvtvlrfgsddealaianateyglgsglwtndl
    srahrmaaridagmcwincykrvnpgspfggvgksgygremgfeamhdytearsvwvnvd
    gnvpphfkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o6rB (B:)
    mahhhhhhmqtqlfidgrfvdavdrgtidvlnphdgsvitkiaaataadvdlavdaatra
    fpawsampaaergrlllrladaieantealaqlesldtghpirdsraldvprtaacfryf
    ggmadklqgsvipvdtgflnyvqrapigvvgqivpwnfplmftswkmgpalaagntvvlk
    pseitplstlrivelmaevgfpagvvnivpgyghtagqrlaehpgvgkiaftgstatgrr
    iveasqgnlkrvqlelggkganivfddanldaaingaawaifhnqgqaciagsrlvlher
    iadaflerfvalassirignpldpntemgpltskqhldrvlsyvdvareqggrvltggsa
    pqdpalangyyvrptiveakhatdrvaqeevfgpfvtvlrfgsddealaianateyglgs
    glwtndlsrahrmaaridagmcwincykrvnpgspfggvgksgygremgfeamhdytear
    svwvnvdgnvpphfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o6rB (B:)
    hmqtqlfidgrfvdavdrgtidvlnphdgsvitkiaaataadvdlavdaatrafpawsam
    paaergrlllrladaieantealaqlesldtghpirdsraldvprtaacfryfggmadkl
    qgsvipvdtgflnyvqrapigvvgqivpwnfplmftswkmgpalaagntvvlkpseitpl
    stlrivelmaevgfpagvvnivpgyghtagqrlaehpgvgkiaftgstatgrriveasqg
    nlkrvqlelggkganivfddanldaaingaawaifhnqgqaciagsrlvlheriadafle
    rfvalassirignpldpntemgpltskqhldrvlsyvdvareqggrvltggsapqdpala
    ngyyvrptiveakhatdrvaqeevfgpfvtvlrfgsddealaianateyglgsglwtndl
    srahrmaaridagmcwincykrvnpgspfggvgksgygremgfeamhdytearsvwvnvd
    gnvpphfkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4o6rC (C:)
    mahhhhhhmqtqlfidgrfvdavdrgtidvlnphdgsvitkiaaataadvdlavdaatra
    fpawsampaaergrlllrladaieantealaqlesldtghpirdsraldvprtaacfryf
    ggmadklqgsvipvdtgflnyvqrapigvvgqivpwnfplmftswkmgpalaagntvvlk
    pseitplstlrivelmaevgfpagvvnivpgyghtagqrlaehpgvgkiaftgstatgrr
    iveasqgnlkrvqlelggkganivfddanldaaingaawaifhnqgqaciagsrlvlher
    iadaflerfvalassirignpldpntemgpltskqhldrvlsyvdvareqggrvltggsa
    pqdpalangyyvrptiveakhatdrvaqeevfgpfvtvlrfgsddealaianateyglgs
    glwtndlsrahrmaaridagmcwincykrvnpgspfggvgksgygremgfeamhdytear
    svwvnvdgnvpphfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o6rC (C:)
    hmqtqlfidgrfvdavdrgtidvlnphdgsvitkiaaataadvdlavdaatrafpawsam
    paaergrlllrladaieantealaqlesldtghpirdsraldvprtaacfryfggmadkl
    qgsvipvdtgflnyvqrapigvvgqivpwnfplmftswkmgpalaagntvvlkpseitpl
    stlrivelmaevgfpagvvnivpgyghtagqrlaehpgvgkiaftgstatgrriveasqg
    nlkrvqlelggkganivfddanldaaingaawaifhnqgqaciagsrlvlheriadafle
    rfvalassirignpldpntemgpltskqhldrvlsyvdvareqggrvltggsapqdpala
    ngyyvrptiveakhatdrvaqeevfgpfvtvlrfgsddealaianateyglgsglwtndl
    srahrmaaridagmcwincykrvnpgspfggvgksgygremgfeamhdytearsvwvnvd
    gnvpphfkr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4o6rD (D:)
    mahhhhhhmqtqlfidgrfvdavdrgtidvlnphdgsvitkiaaataadvdlavdaatra
    fpawsampaaergrlllrladaieantealaqlesldtghpirdsraldvprtaacfryf
    ggmadklqgsvipvdtgflnyvqrapigvvgqivpwnfplmftswkmgpalaagntvvlk
    pseitplstlrivelmaevgfpagvvnivpgyghtagqrlaehpgvgkiaftgstatgrr
    iveasqgnlkrvqlelggkganivfddanldaaingaawaifhnqgqaciagsrlvlher
    iadaflerfvalassirignpldpntemgpltskqhldrvlsyvdvareqggrvltggsa
    pqdpalangyyvrptiveakhatdrvaqeevfgpfvtvlrfgsddealaianateyglgs
    glwtndlsrahrmaaridagmcwincykrvnpgspfggvgksgygremgfeamhdytear
    svwvnvdgnvpphfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o6rD (D:)
    hmqtqlfidgrfvdavdrgtidvlnphdgsvitkiaaataadvdlavdaatrafpawsam
    paaergrlllrladaieantealaqlesldtghpirdsraldvprtaacfryfggmadkl
    qgsvipvdtgflnyvqrapigvvgqivpwnfplmftswkmgpalaagntvvlkpseitpl
    stlrivelmaevgfpagvvnivpgyghtagqrlaehpgvgkiaftgstatgrriveasqg
    nlkrvqlelggkganivfddanldaaingaawaifhnqgqaciagsrlvlheriadafle
    rfvalassirignpldpntemgpltskqhldrvlsyvdvareqggrvltggsapqdpala
    ngyyvrptiveakhatdrvaqeevfgpfvtvlrfgsddealaianateyglgsglwtndl
    srahrmaaridagmcwincykrvnpgspfggvgksgygremgfeamhdytearsvwvnvd
    gnvpphfkr