PDB entry 4o5m

View 4o5m on RCSB PDB site
Description: X-ray Crystal Structure of Isovaleryl-CoA Dehydrogenase from Brucella suis
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, oxidoreductase
Deposited on 2013-12-19, released 2014-01-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isovaleryl-coa dehydrogenase
    Species: Brucella suis [TaxId:204722]
    Gene: ivd, BR0020, BS1330_I0020
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G3C9 (8-End)
      • expression tag (4-7)
    Domains in SCOPe 2.06: d4o5ma1, d4o5ma2, d4o5ma3
  • Chain 'B':
    Compound: isovaleryl-coa dehydrogenase
    Species: Brucella suis [TaxId:204722]
    Gene: ivd, BR0020, BS1330_I0020
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G3C9 (8-389)
      • expression tag (5-7)
    Domains in SCOPe 2.06: d4o5mb1, d4o5mb2, d4o5mb3
  • Chain 'C':
    Compound: isovaleryl-coa dehydrogenase
    Species: Brucella suis [TaxId:204722]
    Gene: ivd, BR0020, BS1330_I0020
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G3C9 (8-389)
      • expression tag (4-7)
    Domains in SCOPe 2.06: d4o5mc1, d4o5mc2, d4o5mc3
  • Chain 'D':
    Compound: isovaleryl-coa dehydrogenase
    Species: Brucella suis [TaxId:204722]
    Gene: ivd, BR0020, BS1330_I0020
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G3C9 (8-389)
      • expression tag (4-7)
    Domains in SCOPe 2.06: d4o5md1, d4o5md2, d4o5md3
  • Heterogens: CA, PG5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o5mA (A:)
    mahhhhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlg
    itapedyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylp
    klisgehvgalamsepgagsdvvsmklaaekrgdryvlngnkmwitngpdadvlvvyakt
    dlsagprgisafiiekgfkgfstaqkldklgmrgsntcelvfedcevpaenllgtegkgv
    nvlmsgldyervvlaggplgimaacldvvvpyvherkqfdqpigefqlmqckladmyvtf
    nasrayvyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngyindyptgrl
    lrdaklyeigagtseirrmligrelfqetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5mA (A:)
    hhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlgitap
    edyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylpklis
    gehvgalamklaaekrgdryvlngnkmwitngpdadvlvvyaktgisafiiekgfkgfst
    aqkldklgmrgsntcelvfedcevpaenllgldyervvlaggplgimaacldvvvpyvhe
    rkqfdqpgefqlmqckladmyvtfnasrayvyavaaacdrgettrkdaagcilysaenat
    qmalqaiqslggngyindyptgrllrdaklyeigagirrmligrelfqet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o5mB (B:)
    mahhhhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlg
    itapedyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylp
    klisgehvgalamsepgagsdvvsmklaaekrgdryvlngnkmwitngpdadvlvvyakt
    dlsagprgisafiiekgfkgfstaqkldklgmrgsntcelvfedcevpaenllgtegkgv
    nvlmsgldyervvlaggplgimaacldvvvpyvherkqfdqpigefqlmqckladmyvtf
    nasrayvyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngyindyptgrl
    lrdaklyeigagtseirrmligrelfqetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5mB (B:)
    hhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlgitape
    dyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylpklisg
    ehvgaladryvlngnkmwitngpdadvlvvyaktsafiiekgfkgfstaqkldklgmrgs
    ntcelvfedcevpaenllgtegkgvnvlmsgldyervvlaggplgimaacldvvvpyvhe
    refqlmqckladmyvtfnasrayvyavaaacdrgettrkdaagcilysaenatqmalqai
    qslggngyindyptgrllrdaklyeieirrmligrelfqetr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4o5mC (C:)
    mahhhhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlg
    itapedyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylp
    klisgehvgalamsepgagsdvvsmklaaekrgdryvlngnkmwitngpdadvlvvyakt
    dlsagprgisafiiekgfkgfstaqkldklgmrgsntcelvfedcevpaenllgtegkgv
    nvlmsgldyervvlaggplgimaacldvvvpyvherkqfdqpigefqlmqckladmyvtf
    nasrayvyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngyindyptgrl
    lrdaklyeigagtseirrmligrelfqetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5mC (C:)
    hhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlgitap
    edyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylpklis
    gehvgalamsmklaaekrgdryvlngnkmwitngpdadvlvvyaktdisafiiekgfkgf
    staqkldklgmrgsntcelvfedcevpaenllgtegkgvnvlmsgldyervvlaggplgi
    maacldvvvpyvhergefqlmqckladmyvtfnasrayvyavaaacdrgettrkdaagci
    lysaenatqmalqaiqslggngyindyptgrllrdaklyeigagtseirrmligrelfqe
    tr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4o5mD (D:)
    mahhhhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlg
    itapedyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylp
    klisgehvgalamsepgagsdvvsmklaaekrgdryvlngnkmwitngpdadvlvvyakt
    dlsagprgisafiiekgfkgfstaqkldklgmrgsntcelvfedcevpaenllgtegkgv
    nvlmsgldyervvlaggplgimaacldvvvpyvherkqfdqpigefqlmqckladmyvtf
    nasrayvyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngyindyptgrl
    lrdaklyeigagtseirrmligrelfqetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5mD (D:)
    hhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlgitap
    edyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylpklis
    gehvgalamsmklaaekrgdryvlngnkmwitngpdadvlvvyaktgisafiiekgfkgf
    staqkldklgmrgsntcelvfedcevpaenllgtegkgvnvlmsgldyervvlaggplgi
    maacldvvvpyvherkqfdqpigefqlmqckladmyvtfnasrayvyavaaacdrgettr
    kdaagcilysaenatqmalqaiqslggngdyptgrllrdaklyeirmligrelfqetr