PDB entry 4o5l

View 4o5l on RCSB PDB site
Description: Crystal structure of broadly neutralizing antibody F045-092
Class: immune system
Keywords: Fab, Fragment antigen binding, Immunoglobulin fold, immune system
Deposited on 2013-12-19, released 2014-04-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.176
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab F045-092 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot 4O5L (0-102)
    • Uniprot A8K008 (118-233)
      • expression tag (234-239)
  • Chain 'L':
    Compound: Fab F045-092 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4o5ll1, d4o5ll2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4o5lL (L:)
    qsvltqppsasgtpgqsvtiscsgsrsniggntvnwyqhlpgmapklliyssnqrssgvp
    drfsgsksgtsaslaisglqseddadyycaswddslngvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecsarlgggdykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5lL (L:)
    qsvltqppsasgtpgqsvtiscsgsrsniggntvnwyqhlpgmapklliyssnqrssgvp
    drfsgsksgtsaslaisglqseddadyycaswddslngvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptec