PDB entry 4o5h

View 4o5h on RCSB PDB site
Description: X-ray crystal structure of a putative phenylacetaldehyde dehydrogenase from Burkholderia cenocepacia
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, phenylacetaldehyde dehydrogenase, Oxidoreductase
Deposited on 2013-12-19, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylacetaldehyde dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM2298
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EH14 (7-510)
      • expression tag (0-6)
      • expression tag (8)
    Domains in SCOPe 2.07: d4o5ha1, d4o5ha2
  • Chain 'B':
    Compound: Phenylacetaldehyde dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM2298
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EH14 (7-510)
      • expression tag (0-6)
      • expression tag (8)
    Domains in SCOPe 2.07: d4o5hb1, d4o5hb2
  • Chain 'C':
    Compound: Phenylacetaldehyde dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM2298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4o5hc_
  • Chain 'D':
    Compound: Phenylacetaldehyde dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM2298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4o5hd_
  • Heterogens: GOL, EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4o5hA (A:)
    ahhhhhhmvnmetnetfalldatraflakpkqmligaewsdaasgrqldvvnpadgtvia
    rvpeaderdvqqavaaarrafdagpwrtakttdrerlmlvladlieanarelaeiesldn
    gkpvmvaqgldvamaaqcfrymagwatkiegsvidagmpylpdseifaytrkepvgvvga
    iipwnfpllmaawkiapalatgctvvlkpaedtplsalrlgeliqaagfpdgvvnivtgy
    ghtagaalsrdpridkiaftgstqtgktighaaldnmtrmslelggkspvivlpdvdldk
    aaqgvanaiffnqgqvctagsrayihskvfdgviervakiaaslkigpgmdpatqigplv
    sakqrervcgyidsgfgegaraaaggraidgpgffveptvlvdttqamrvvreeifgpvl
    vampfddvdtavqlandtpyglgasiwsndlsaihklvpriaagtvwvnchslldnalpf
    ggmkqsgfgrelgravidqytesksvmmnya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4o5hB (B:)
    ahhhhhhmvnmetnetfalldatraflakpkqmligaewsdaasgrqldvvnpadgtvia
    rvpeaderdvqqavaaarrafdagpwrtakttdrerlmlvladlieanarelaeiesldn
    gkpvmvaqgldvamaaqcfrymagwatkiegsvidagmpylpdseifaytrkepvgvvga
    iipwnfpllmaawkiapalatgctvvlkpaedtplsalrlgeliqaagfpdgvvnivtgy
    ghtagaalsrdpridkiaftgstqtgktighaaldnmtrmslelggkspvivlpdvdldk
    aaqgvanaiffnqgqvctagsrayihskvfdgviervakiaaslkigpgmdpatqigplv
    sakqrervcgyidsgfgegaraaaggraidgpgffveptvlvdttqamrvvreeifgpvl
    vampfddvdtavqlandtpyglgasiwsndlsaihklvpriaagtvwvnchslldnalpf
    ggmkqsgfgrelgravidqytesksvmmnya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4o5hC (C:)
    ahhhhhhmvnmetnetfalldatraflakpkqmligaewsdaasgrqldvvnpadgtvia
    rvpeaderdvqqavaaarrafdagpwrtakttdrerlmlvladlieanarelaeiesldn
    gkpvmvaqgldvamaaqcfrymagwatkiegsvidagmpylpdseifaytrkepvgvvga
    iipwnfpllmaawkiapalatgctvvlkpaedtplsalrlgeliqaagfpdgvvnivtgy
    ghtagaalsrdpridkiaftgstqtgktighaaldnmtrmslelggkspvivlpdvdldk
    aaqgvanaiffnqgqvctagsrayihskvfdgviervakiaaslkigpgmdpatqigplv
    sakqrervcgyidsgfgegaraaaggraidgpgffveptvlvdttqamrvvreeifgpvl
    vampfddvdtavqlandtpyglgasiwsndlsaihklvpriaagtvwvnchslldnalpf
    ggmkqsgfgrelgravidqytesksvmmnya
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5hC (C:)
    tfalldatraflakpkqmligaewsdaasgrqldvvnpadgtviarvpeaderdvqqava
    aarrafdagpwrtakttdrerlmlvladlieanarelaeiesldngkpvmvaqgldvama
    aqcfrymagwatkiegsvidagmpylpdseifaytrkepvgvvgaiipwnfpllmaawki
    apalatgctvvlkpaedtplsalrlgeliqaagfpdgvvnivtgyghtagaalsrdprid
    kiaftgstqtgktighaaldnmtrmslelggkspvivlpdvdldkaaqgvanaiffnqgq
    vctagsrayihskvfdgviervakiaaslkigpgmdpatqigplvsakqrervcgyidsg
    fgegaraaaggraidgpgffveptvlvdttqamrvvreeifgpvlvampfddvdtavqla
    ndtpyglgasiwsndlsaihklvpriaagtvwvnchslldnalpfggmkqsgfgrelgra
    vidqytesksvmmnya
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4o5hD (D:)
    ahhhhhhmvnmetnetfalldatraflakpkqmligaewsdaasgrqldvvnpadgtvia
    rvpeaderdvqqavaaarrafdagpwrtakttdrerlmlvladlieanarelaeiesldn
    gkpvmvaqgldvamaaqcfrymagwatkiegsvidagmpylpdseifaytrkepvgvvga
    iipwnfpllmaawkiapalatgctvvlkpaedtplsalrlgeliqaagfpdgvvnivtgy
    ghtagaalsrdpridkiaftgstqtgktighaaldnmtrmslelggkspvivlpdvdldk
    aaqgvanaiffnqgqvctagsrayihskvfdgviervakiaaslkigpgmdpatqigplv
    sakqrervcgyidsgfgegaraaaggraidgpgffveptvlvdttqamrvvreeifgpvl
    vampfddvdtavqlandtpyglgasiwsndlsaihklvpriaagtvwvnchslldnalpf
    ggmkqsgfgrelgravidqytesksvmmnya
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5hD (D:)
    tfalldatraflakpkqmligaewsdaasgrqldvvnpadgtviarvpeaderdvqqava
    aarrafdagpwrtakttdrerlmlvladlieanarelaeiesldngkpvmvaqgldvama
    aqcfrymagwatkiegsvidagmpylpdseifaytrkepvgvvgaiipwnfpllmaawki
    apalatgctvvlkpaedtplsalrlgeliqaagfpdgvvnivtgyghtagaalsrdprid
    kiaftgstqtgktighaaldnmtrmslelggkspvivlpdvdldkaaqgvanaiffnqgq
    vctagsrayihskvfdgviervakiaaslkigpgmdpatqigplvsakqrervcgyidsg
    fgegaraaaggraidgpgffveptvlvdttqamrvvreeifgpvlvampfddvdtavqla
    ndtpyglgasiwsndlsaihklvpriaagtvwvnchslldnalpfggmkqsgfgrelgra
    vidqytesksvmmnya