PDB entry 4o07

View 4o07 on RCSB PDB site
Description: Identification of novel HSP90/isoform selective inhibitors using structure-based drug design. Demonstration of potential utility in treating CNS disorders such as Huntington's disease
Class: chaperone/chaperone inhibitor
Keywords: chaperone, CHAPERONE-CHAPERONE INHIBITOR complex
Deposited on 2013-12-13, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4o07a_
  • Heterogens: FGH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o07A (A:)
    gslhmdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryes
    ltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealq
    agadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrg
    tkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o07A (A:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhsqfigypitlfvek