PDB entry 4nzu

View 4nzu on RCSB PDB site
Description: Crystal structure of the primary monoclonal antibody 13PL Fab' from a multiple myeloma patient
Class: immune system
Keywords: antibody Fab, multiple myeloma, primary antibody, IMMUNE SYSTEM
Deposited on 2013-12-12, released 2014-02-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.137
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 13PL light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NZU (0-224)
  • Chain 'L':
    Compound: 13PL heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NZU (0-210)
    Domains in SCOPe 2.03: d4nzul1, d4nzul2
  • Heterogens: GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4nzuL (L:)
diemtqspsslsastgdkvtitcqasqdiakfldwyqqrpgktpklliydasnlaigvps
rftgsgsgtdftftisslqpediavyycqhyddfpisfgpgtkletkrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnr