PDB entry 4nzt

View 4nzt on RCSB PDB site
Description: Crystal structure of the antibody-binding region of Protein M (Protein M TD) in complex with anti-infleunza hemagglutinin antibody CR9114 Fab
Class: protein binding/immune system
Keywords: Leucine-rich repeat, broad antibody-binding, block antibody-antigen union, variable region, PROTEIN BINDING-IMMUNE SYSTEM complex
Deposited on 2013-12-12, released 2014-02-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CR9114 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NZT
  • Chain 'L':
    Compound: CR9114 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NZT
    Domains in SCOPe 2.04: d4nztl1, d4nztl2
  • Chain 'M':
    Compound: Protein M TD
    Species: Mycoplasma genitalium [TaxId:243273]
    Gene: MG281
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nztL (L:)
    qsaltqppavsgtpgqrvtiscsgsdsnigrrsvnwyqqfpgtapklliysndqrpsvvp
    drfsgsksgtsaslaisglqsedeaeyycaawddslkgavfgggtqltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nztL (L:)
    saltqppavsgtpgqrvtiscsgsdsnigrrsvnwyqqfpgtapklliysndqrpsvvpd
    rfsgsksgtsaslaisglqsedeaeyycaawddslkgavfgggtqltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'M':
    No sequence available.