PDB entry 4nzr

View 4nzr on RCSB PDB site
Description: Crystal structure of the antibody-binding region of Protein M (Protein M TD) in complex with anti-HIV antibody PGT135 Fab
Class: immune system/protein binding
Keywords: Leucine-rich repeat, broad antibody-binding, block antibody-antigen union, variable region, IMMUNE SYSTEM-PROTEIN BINDING complex
Deposited on 2013-12-12, released 2014-02-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.156
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: PGT135 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NZR (0-233)
  • Chain 'L':
    Compound: PGT135 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NZR (0-213)
    Domains in SCOPe 2.04: d4nzrl1, d4nzrl2
  • Chain 'M':
    Compound: Protein M TD
    Species: Mycoplasma genitalium [TaxId:243273]
    Gene: MG281
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nzrL (L:)
    eivmtqspdtlsvspgetvtlscrasqninknlawyqykpgqsprlvifetyskiaafpa
    rfvasgsgteftltinnmqsedvavyycqqyeewprtfgqgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'M':
    No sequence available.