PDB entry 4nzb

View 4nzb on RCSB PDB site
Description: NS9283 bound to Ls-AChBP
Class: acetylcholine-binding protein
Keywords: Acetylcholine-binding protein, NS9283, AChBP-modulator complex
Deposited on 2013-12-11, released 2014-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.208
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzba_
  • Chain 'B':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbb_
  • Chain 'C':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbc_
  • Chain 'D':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbd_
  • Chain 'E':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbe_
  • Chain 'F':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbf_
  • Chain 'G':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbg_
  • Chain 'H':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbh_
  • Chain 'I':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbi_
  • Chain 'J':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbj_
  • Chain 'K':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbk_
  • Chain 'L':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbl_
  • Chain 'M':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbm_
  • Chain 'N':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbn_
  • Chain 'O':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nzbo_
  • Heterogens: 1PE, NAG, SO4, ACT, NSE, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nzbA (A:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbA (A:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nzbB (B:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbB (B:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nzbC (C:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbC (C:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nzbD (D:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbD (D:)
    dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
    tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
    scdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtysc
    cpeayedvevslnfrkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4nzbE (E:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbE (E:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4nzbF (F:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbF (F:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildvtqkknsvt
    ysccpeayedvevslnfrkk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4nzbG (G:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbG (G:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4nzbH (H:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbH (H:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4nzbI (I:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbI (I:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtyp
    eayedvevslnfrkk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4nzbJ (J:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbJ (J:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4nzbK (K:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbK (K:)
    ldradilynirqtsrpdviptqrpvavsvslkfinilevneitnevdvvfwqqttwsdrt
    lawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrfs
    cdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtyscc
    peayedvevslnfrkkg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nzbL (L:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbL (L:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4nzbM (M:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbM (M:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtye
    ayedvevslnfrkk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4nzbN (N:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbN (N:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4nzbO (O:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nzbO (O:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk