PDB entry 4nx3

View 4nx3 on RCSB PDB site
Description: Structure of the core ectodomain of the hepatitis C virus envelope glycoprotein 2
Class: immune system/viral protein
Keywords: HEPATITIS C VIRUS, ENVELOPE GLYCOPROTEIN 2, E2, HCV, Mouse Fab Heavy Chain, Mouse Fab Light Chain, Antigen recognition, Antigen, glycosylation, IMMUNE SYSTEM-VIRAL PROTEIN complex
Deposited on 2013-12-08, released 2014-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mouse Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NX3
    Domains in SCOPe 2.08: d4nx3a3, d4nx3a4
  • Chain 'B':
    Compound: Mouse Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NX3
  • Chain 'D':
    Compound: hcv e2
    Species: Hepatitis C virus subtype 2a [TaxId:31649]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, ARF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4nx3A (A:)
mesqtqvlmflllwvsgacadivmtqspsslamsvgqkvtmsckssqsllnsnnqknyla
wyqqkpgqspkllvyfastresgvpdrfigsgsgtdftltissvqaedladyfcqqhyst
pytfgggtkleirradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgse
rqngvlnswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

    Sequence, based on observed residues (ATOM records): (download) 
    >4nx3A (A:)
divmtqspsslamsvgqkvtmsckssqsllnsnnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedladyfcqqhystpytfgggtkleirradaapt
vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
msstltltkdeyerhnsytceathktstspivksfnr

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    No sequence available.