PDB entry 4nwu

View 4nwu on RCSB PDB site
Description: Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in CDR H1
Class: immune system
Keywords: beta-sandwich, human beta nerve growth factor, IMMUNE SYSTEM
Deposited on 2013-12-06, released 2014-10-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: APE1551 Ab Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 4NWU (Start-144)
    • Uniprot P01857 (145-End)
  • Chain 'L':
    Compound: APE1551 Ab Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NWU (0-110)
    • Uniprot Q8TCD0 (111-219)
    Domains in SCOPe 2.05: d4nwul1, d4nwul2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4nwuL (L:)
divmtqspdslavslgeratinckssqsvlyssnnknyltwyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqydnypitfgqgtrleikrtvaaps
vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
lsstltlskadyekhkvyacevthqglsspvtksfnrgec