PDB entry 4nwt

View 4nwt on RCSB PDB site
Description: Crystal structure of the anti-human NGF Fab APE1531
Class: immune system
Keywords: beta sandwich, human beta nerve growth factor, IMMUNE SYSTEM
Deposited on 2013-12-06, released 2014-10-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.152
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: APE1531 Ab Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 4NWT (0-115)
    • Uniprot P01857 (136-222)
  • Chain 'L':
    Compound: APE1531 Ab Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NWT (0-110)
    • Uniprot Q8TCD0 (111-219)
    Domains in SCOPe 2.04: d4nwtl1, d4nwtl2
  • Heterogens: MES, ACT, PGE, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4nwtL (L:)
divmtqspdslavslgeratinckssqsvlyssnnknyltwyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqydnypitfgqgtrleikrtvaaps
vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
lsstltlskadyekhkvyacevthqglsspvtksfnrgec