PDB entry 4nvp

View 4nvp on RCSB PDB site
Description: Structure of the cyclic nucleotide-binding domain of HCN4 channel complexed with 7-CH-cAMP
Class: transport protein
Keywords: cyclic nucleotide binding domain, Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel, cytoplasmic domain, TRANSPORT PROTEIN
Deposited on 2013-12-05, released 2014-03-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3Q4 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d4nvpa1, d4nvpa2
  • Heterogens: 7CH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nvpA (A:)
    gpsspmdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgels
    eplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyf
    iqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevle
    eypmmrrafetvaldrldrigkknsillh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nvpA (A:)
    spmdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelsepl
    reeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqh
    gvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeyp
    mmrrafetvaldrldrigkkn