PDB entry 4nug

View 4nug on RCSB PDB site
Description: Crystal structure of HIV-1 broadly neutralizing antibody PGT151
Class: immune system
Keywords: immunoglobulin, Fab fragment, IMMUNE SYSTEM, HIV Envelope
Deposited on 2013-12-03, released 2014-05-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.161
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: PGT151 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NUG (0-103)
    • Uniprot S6BAM6 (103-End)
  • Chain 'L':
    Compound: PGT151 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NUG (0-110)
    • Uniprot Q8TCD0 (111-End)
    Domains in SCOPe 2.06: d4nugl1, d4nugl2
  • Heterogens: P6G, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nugL (L:)
    divmtqtplslsvtpgqpasiscksseslrqsngktslywyrqkpgqspqllvfevsnrf
    sgvsdrfvgsgsgtdftlrisrveaedvgfyycmqskdfpltfgggtkvdlkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nugL (L:)
    divmtqtplslsvtpgqpasiscksseslrqsngktslywyrqkpgqspqllvfevsnrf
    sgvsdrfvgsgsgtdftlrisrveaedvgfyycmqskdfpltfgggtkvdlkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge