PDB entry 4nst

View 4nst on RCSB PDB site
Description: Crystal structure of human Cdk12/Cyclin K in complex with ADP-aluminum fluoride
Class: transferase/transcription
Keywords: transcription, RNA polymerase II, phosphorylation, TRANSFERASE-TRANSCRIPTION complex
Deposited on 2013-11-29, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK12, CRK7, CRKRS, KIAA0904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nsta_
  • Chain 'B':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNK, CPR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nstb1, d4nstb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK12, CRK7, CRKRS, KIAA0904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nstc_
  • Chain 'D':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNK, CPR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nstd1, d4nstd2
  • Heterogens: ADP, AF3, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nstA (A:)
    gqtesdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitai
    reikilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfs
    edhiksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpy
    tnkvitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlc
    gspcpavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctae
    qtlqsdflkdvelskmappdlphwqdchelwskkrrrqrqsgvvveeppps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nstA (A:)
    esdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitairei
    kilrqlihrsvvnmkeivtdkqdgafylvfeymdhdlmgllesglvhfsedhiksfmkql
    megleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvitlwyrp
    pelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpdv
    iklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkdv
    elskmappdlphwqdchelwskk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nstB (B:)
    gmkenkensspsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifd
    vgtrlglhydtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiikt
    arsllndvqfgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiq
    klvqmawtfvndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfv
    qdvpvdvledichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nstB (B:)
    tkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfh
    rfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkee
    vmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlsl
    qwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlys
    qgkqqm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nstC (C:)
    gqtesdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitai
    reikilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfs
    edhiksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpy
    tnkvitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlc
    gspcpavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctae
    qtlqsdflkdvelskmappdlphwqdchelwskkrrrqrqsgvvveeppps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nstC (C:)
    sdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireik
    ilrqlihrsvvnmkeivtdkgafylvfeymdhdlmgllesglvhfsedhiksfmkqlmeg
    leychkknflhrdikcsnillnnsgqikladfglarlynsesrpytnkvitlwyrppell
    lgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpdviklp
    yfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkdvelsk
    mappdlphwqdchelwsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nstD (D:)
    gmkenkensspsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifd
    vgtrlglhydtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiikt
    arsllndvqfgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiq
    klvqmawtfvndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfv
    qdvpvdvledichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nstD (D:)
    kpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhr
    fymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeev
    mvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslq
    wepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysq
    g