PDB entry 4nrz

View 4nrz on RCSB PDB site
Description: Crystal Structure of HIV-1 Neutralizing Antibody m66.6
Class: immune system
Keywords: Immunoglobulin, Neutralizing Antibody, HIV-1 gp41, Membrane Proximal External Region, MPER, IMMUNE SYSTEM
Deposited on 2013-11-27, released 2014-02-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.178
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: m66.6 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NRZ (0-End)
  • Chain 'B':
    Compound: m66.6 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NRZ (0-End)
    Domains in SCOPe 2.04: d4nrzb1, d4nrzb2
  • Chain 'H':
    Compound: m66.6 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NRZ (0-End)
  • Chain 'L':
    Compound: m66.6 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NRZ (0-212)
    Domains in SCOPe 2.04: d4nrzl1, d4nrzl2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nrzB (B:)
    diqltqspsslsaslgdkvtitcrasqhikkylnwyqqkpgkapklliygalnlqsgvps
    rfsgrgsgtdftltisslqpedfatyycqqsystpftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nrzB (B:)
    diqltqspsslsaslgdkvtitcrasqhikkylnwyqqkpgkapklliygalnlqsgvps
    rfsgrgsgtdftltisslqpedfatyycqqsystpftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nrzL (L:)
    diqltqspsslsaslgdkvtitcrasqhikkylnwyqqkpgkapklliygalnlqsgvps
    rfsgrgsgtdftltisslqpedfatyycqqsystpftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge