PDB entry 4nrr

View 4nrr on RCSB PDB site
Description: Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-frucose
Class: hydrolase
Keywords: Tim Barrel, Hydrolase, extracellular protein
Deposited on 2013-11-27, released 2014-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.146
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exo-beta-1,4-mannosidase
    Species: Rhizomucor miehei [TaxId:4839]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NRR (Start-448)
    Domains in SCOPe 2.06: d4nrra1, d4nrra2
  • Chain 'B':
    Compound: Exo-beta-1,4-mannosidase
    Species: Rhizomucor miehei [TaxId:4839]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NRR
    Domains in SCOPe 2.06: d4nrrb1, d4nrrb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nrrA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefafvkiasdgkgftrygepylirga
    nywqgmnlgaddcsggdrkrmeleikqmaemginnlrvmassegpddqpyrmrpsmmpqp
    gkynegvfvgldylldtmdrynmtavmtlgnfwqwsggfgqyvawitgnqtipypvgdvt
    ydeftqfaarfyndseiapkanklfkdhiytvqnrrntvngkiykedpvimswqianapq
    eapaswfeeistfikkgapkhlvsagleskldeydfdrahdhknidyttchcwvenwgiy
    dpadpdglphaneymhdflesrskwaaqlnkpivmeefgmardawrnpedetykylpstp
    tshkdeyyqkafnqivslasnrsfsgsnfwayggegrstyppnpygmvwlgdpphephgw
    ysvysndttvqiikdynanllkvqkelsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nrrA (A:)
    sefafvkiasdgkgftrygepylirganywqgmnlgaddcsggdrkrmeleikqmaemgi
    nnlrvmassegpddqpyrmrpsmmpqpgkynegvfvgldylldtmdrynmtavmtlgnfw
    qwsggfgqyvawitgnqtipypvgdvtydeftqfaarfyndseiapkanklfkdhiytvq
    nrrntvngkiykedpvimswqianapqeapaswfeeistfikkgapkhlvsaglesklde
    ydfdrahdhknidyttchcwvenwgiydpadpdglphaneymhdflesrskwaaqlnkpi
    vmeefgmardawrnpedetykylpstptshkdeyyqkafnqivslasnrsfsgsnfwayg
    gegrstyppnpygmvwlgdpphephgwysvysndttvqiikdynanllkvqkelsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nrrB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefafvkiasdgkgftrygepylirga
    nywqgmnlgaddcsggdrkrmeleikqmaemginnlrvmassegpddqpyrmrpsmmpqp
    gkynegvfvgldylldtmdrynmtavmtlgnfwqwsggfgqyvawitgnqtipypvgdvt
    ydeftqfaarfyndseiapkanklfkdhiytvqnrrntvngkiykedpvimswqianapq
    eapaswfeeistfikkgapkhlvsagleskldeydfdrahdhknidyttchcwvenwgiy
    dpadpdglphaneymhdflesrskwaaqlnkpivmeefgmardawrnpedetykylpstp
    tshkdeyyqkafnqivslasnrsfsgsnfwayggegrstyppnpygmvwlgdpphephgw
    ysvysndttvqiikdynanllkvqkelsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nrrB (B:)
    gsefafvkiasdgkgftrygepylirganywqgmnlgaddcsggdrkrmeleikqmaemg
    innlrvmassegpddqpyrmrpsmmpqpgkynegvfvgldylldtmdrynmtavmtlgnf
    wqwsggfgqyvawitgnqtipypvgdvtydeftqfaarfyndseiapkanklfkdhiytv
    qnrrntvngkiykedpvimswqianapqeapaswfeeistfikkgapkhlvsagleskld
    eydfdrahdhknidyttchcwvenwgiydpadpdglphaneymhdflesrskwaaqlnkp
    ivmeefgmardawrnpedetykylpstptshkdeyyqkafnqivslasnrsfsgsnfway
    ggegrstyppnpygmvwlgdpphephgwysvysndttvqiikdynanllkvqkel