PDB entry 4nr1

View 4nr1 on RCSB PDB site
Description: Factor inhibiting HIF-1 alpha in complex with consensus ankyrin repeat domain-(d)allyl-GLY peptide
Class: oxidoreductase
Keywords: on-heme, dioxygenase, oxygenase, DNA-binding, metal-binding, transcription, helix-loop-helix-beta, dsbh, facial triad, asparaginyl/aspartyl hydroxylase, epigenetic regulation, signaling, ard, beta-hydroxylation,activator-inhibitor,oxidoreductase-peptide complex, oxidoreductase
Deposited on 2013-11-26, released 2015-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.164
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: FIH1, HIF1AN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nr1a_
  • Chain 'S':
    Compound: CONSENSUS ANKYRIN REPEAT DOMAIN-(D)allyl glycine
    Database cross-references and differences (RAF-indexed):
    • PDB 4NR1
  • Heterogens: ZN, OGA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nr1A (A:)
    gshmaataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelie
    neepvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkpr
    snreemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkr
    gwgqltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcd
    rqsqvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwy
    kgaptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nr1A (A:)
    epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
    kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
    iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
    vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
    fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkahq
    kvaimrniekmlgealgnpqevgpllntmikgryn
    

  • Chain 'S':
    No sequence available.