PDB entry 4nql

View 4nql on RCSB PDB site
Description: The crystal structure of the DUB domain of AMSH orthologue, Sst2 from S. pombe, in complex with lysine 63-linked diubiquitin
Class: hydrolase/protein binding
Keywords: JAMM domain, Zinc metalloprotease, protein complex, AMSH, heix-beta-helix sandwich, hydrolase, metal binding, K63-linked diubiquitin, Helix-beta-helix sandwich, Deubiquitinase, Ubiquitin, Hse1, cytosol, endosome, HYDROLASE-PROTEIN BINDING complex
Deposited on 2013-11-25, released 2014-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AMSH-like protease sst2
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: SPAC19B12.10, sst2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P371
      • conflict (71)
      • conflict (139)
  • Chain 'B':
    Compound: Ubiquitin
    Species: Mus musculus [TaxId:10090]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG50 (0-75)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d4nqlb_
  • Chain 'C':
    Compound: Ubiquitin
    Species: Mus musculus [TaxId:10090]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4nqlB (B:)
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqrestlhlvlrlrgg

  • Chain 'C':
    No sequence available.