PDB entry 4npn

View 4npn on RCSB PDB site
Description: Crystal structure of human tetra-SUMO-2
Class: protein transport
Keywords: protein binding, protein transport
Deposited on 2013-11-22, released 2014-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMT3A, SMT3H2, SUMO2, SUMO2 SMT3A SMT3H2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4npna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4npnA (A:)
    gshmasmtggqqmgrgseftenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqg
    lsmrqirfrfdgqpinetdtpaqlemededtidvfqqqtggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4npnA (A:)
    hinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaql
    emededtidvf