PDB entry 4npi

View 4npi on RCSB PDB site
Description: 1.94 Angstroms X-ray crystal structure of NAD- and intermediate- bound alpha-aminomuconate-epsilon-semialdehyde dehydrogenase from Pseudomonas fluorescens
Class: Oxidoreductase
Keywords: ALDH, Dehydrogenase, NAD+, Oxidoreductase
Deposited on 2013-11-21, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4npia_
  • Chain 'B':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4npib_
  • Chain 'C':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4npic_
  • Chain 'D':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4npid_
  • Heterogens: NAD, NA, 2VS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4npiA (A:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4npiB (B:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4npiC (C:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4npiD (D:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki