PDB entry 4np4

View 4np4 on RCSB PDB site
Description: Clostridium difficile toxin B CROP domain in complex with FAB domains of neutralizing antibody bezlotoxumab
Class: immune system
Keywords: bezlotoxumab, human antibody, FAB, CROP domain, cytotoxin, short repeat, long repeat, TcdB, receptor binding, IMMUNE SYSTEM
Deposited on 2013-11-20, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxin b
    Species: Clostridium difficile [TaxId:1496]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18177 (1-266)
      • expression tag (267-271)
  • Chain 'H':
    Compound: bezlotoxumab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NP4 (0-End)
  • Chain 'I':
    Compound: bezlotoxumab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NP4 (0-End)
  • Chain 'L':
    Compound: bezlotoxumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NP4 (0-End)
    Domains in SCOPe 2.07: d4np4l1, d4np4l2
  • Chain 'M':
    Compound: bezlotoxumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NP4 (0-End)
    Domains in SCOPe 2.07: d4np4m1, d4np4m2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4np4L (L:)
    eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsstwtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4np4L (L:)
    eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsstwtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4np4M (M:)
    eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsstwtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4np4M (M:)
    eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsstwtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg