PDB entry 4nob

View 4nob on RCSB PDB site
Description: Crystal structure of the 1st Ig domain from mouse Polymeric Immunoglobulin receptor [PSI-NYSGRC-006220]
Class: Immune system
Keywords: Immune system, ortholog, Ig domain, Structural genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, Immune Function Network, IFN
Deposited on 2013-11-19, released 2013-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.163
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymeric immunoglobulin receptor
    Species: Mus musculus [TaxId:10090]
    Gene: PIGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70570 (5-118)
      • expression tag (4)
    Domains in SCOPe 2.07: d4noba1, d4noba2
  • Heterogens: NAG, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nobA (A:)
    qdyggspifgpqevssiegdsvsitcyypdtsvnrhtrkywcrqgasgmcttlissngyl
    skeysgranlinfpenntfvinieqltqddtgsykcglgtsnrglsfdvslevsqvpela
    enlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nobA (A:)
    gspifgpqevssiegdsvsitcyypdtsvnrhtrkywcrqgasgmcttlissngylskey
    sgranlinfpenntfvinieqltqddtgsykcglgtglsfdvslevsqvpel