PDB entry 4nno

View 4nno on RCSB PDB site
Description: Crystal Structure of Manganese ABC transporter substrate-binding protein MntC from Staphylococcus Aureus bound to a Zinc ion
Class: transport protein
Keywords: Manganese transporter, MRSA, ABC superfamily ATP binding cassette transporter, TRANSPORT PROTEIN
Deposited on 2013-11-18, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: SAV0631
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nnoa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nnoA (A:)
    gtggkqssdksngklkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikk
    ltdadvilynglnletgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqd
    phawlsldngikyvktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipke
    qramitsegafkyfskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsv
    dkkameslseetkkdifgevytdsigkegtkgdsyykmmksnietvhgsmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nnoA (A:)
    klkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngln
    letgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngiky
    vktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafky
    fskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseetk
    kdifgevytdsigkegtkgdsyykmmksnietvhgsmk