PDB entry 4nn0

View 4nn0 on RCSB PDB site
Description: Crystal structure of the C1QTNF5 globular domain in space group P63
Class: cell adhesion
Keywords: L-ORMD, late onset retinal macular degeneration, S163R, 10-strand jelly-roll fold, Cellular adhesion, CELL ADHESION
Deposited on 2013-11-15, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.106
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1q tumor necrosis factor-related protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QTNF5, CTRP5, UNQ303/PRO344
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BXJ0 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4nn0a1, d4nn0a2
  • Chain 'B':
    Compound: Complement C1q tumor necrosis factor-related protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QTNF5, CTRP5, UNQ303/PRO344
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BXJ0 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4nn0b1, d4nn0b2
  • Chain 'C':
    Compound: Complement C1q tumor necrosis factor-related protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QTNF5, CTRP5, UNQ303/PRO344
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BXJ0 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4nn0c1, d4nn0c2
  • Heterogens: EDO, SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nn0A (A:)
    arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
    aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
    ktdstfsgflvysdwhsspvfahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nn0A (A:)
    arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
    aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
    ktdstfsgflvysdwhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nn0B (B:)
    arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
    aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
    ktdstfsgflvysdwhsspvfahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nn0B (B:)
    arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
    aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
    ktdstfsgflvysdwhsspvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nn0C (C:)
    arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
    aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
    ktdstfsgflvysdwhsspvfahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nn0C (C:)
    arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
    aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
    ktdstfsgflvysdwhss