PDB entry 4nmj

View 4nmj on RCSB PDB site
Description: Thermostable aldehyde dehydrogenase from Pyrobaculum sp. complexed with NADP+ at 2 A resolution
Class: oxidoreductase
Keywords: aldehyde oxidation, NADP reduction, intracellular, OXIDOREDUCTASE
Deposited on 2013-11-15, released 2014-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nmja_
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nmjb_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nmjc_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nmjd_
  • Chain 'E':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nmje_
  • Chain 'F':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nmjf_
  • Chain 'G':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nmjg_
  • Chain 'H':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nmjh_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nmjA (A:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nmjA (A:)
    imkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawani
    pairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyq
    grvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpv
    tgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaag
    tlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfie
    ryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffe
    paifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafri
    aeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfp
    ipsalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nmjB (B:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nmjB (B:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psalk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nmjC (C:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nmjC (C:)
    kvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipa
    irraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgr
    vlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtg
    wliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtl
    ktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfiery
    vhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepa
    ifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriae
    avesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpip
    salk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nmjD (D:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nmjD (D:)
    vanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipai
    rraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgrv
    lqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtgw
    liaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtlk
    tvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfieryv
    hyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepai
    fvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriaea
    vesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpips
    alk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4nmjE (E:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nmjE (E:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psalk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4nmjF (F:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nmjF (F:)
    idlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealka
    wanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaela
    rhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpas
    dtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaa
    kaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavad
    kfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswg
    nffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnr
    afriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrt
    rrfpipsal
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4nmjG (G:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nmjG (G:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psal
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4nmjH (H:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nmjH (H:)
    kvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipa
    irraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgr
    vlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtg
    wliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtl
    ktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfiery
    vhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepa
    ifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriae
    avesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpip
    salk