PDB entry 4nm4

View 4nm4 on RCSB PDB site
Description: Crystal structure of broadly neutralizing antibody CR8043
Class: immune system
Keywords: Immune system, Immune recognition, Antibody, Fab, Immunoglobulin, Influenza hemagglutinin
Deposited on 2013-11-14, released 2013-12-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.178
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody CR8043, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot S6C4S0 (129-End)
    • PDB 4NM4 (0-End)
  • Chain 'I':
    Compound: Antibody CR8043, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot S6C4S0 (129-End)
    • PDB 4NM4 (0-End)
  • Chain 'L':
    Compound: Antibody CR8043, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01834 (120-End)
    • PDB 4NM4 (0-End)
    Domains in SCOPe 2.04: d4nm4l1, d4nm4l2
  • Chain 'M':
    Compound: Antibody CR8043, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01834 (120-End)
    • PDB 4NM4 (0-End)
    Domains in SCOPe 2.04: d4nm4m1, d4nm4m2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nm4L (L:)
    diqmtqspdslavslgeratinckssqsvfssstnknylawyqqkpgqppkvliywsstr
    esgvpdrfsasgsgtdftltisslqaadvavyychqyytapwtfgqgtkveikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nm4L (L:)
    diqmtqspdslavslgeratinckssqsvfssstnknylawyqqkpgqppkvliywsstr
    esgvpdrfsasgsgtdftltisslqaadvavyychqyytapwtfgqgtkveikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4nm4M (M:)
    diqmtqspdslavslgeratinckssqsvfssstnknylawyqqkpgqppkvliywsstr
    esgvpdrfsasgsgtdftltisslqaadvavyychqyytapwtfgqgtkveikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nm4M (M:)
    diqmtqspdslavslgeratinckssqsvfssstnknylawyqqkpgqppkvliywsstr
    esgvpdrfsasgsgtdftltisslqaadvavyychqyytapwtfgqgtkveikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrge