PDB entry 4nm0

View 4nm0 on RCSB PDB site
Description: Crystal structure of peptide inhibitor-free GSK-3/Axin complex
Class: transferase/peptide
Keywords: Wnt, LRP6, Auto-inhibited, GSK-3, Axin, kinase, primed substrate, TRANSFERASE-PEPTIDE complex
Deposited on 2013-11-14, released 2014-03-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841 (Start-382)
      • expression tag (383)
    Domains in SCOPe 2.03: d4nm0a_
  • Chain 'B':
    Compound: Axin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: AXIN, AXIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15169 (4-End)
      • expression tag (2-3)
  • Heterogens: GOL, MG, ADP, DTT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nm0A (A:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilippharhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nm0A (A:)
    mkvsrdskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvl
    qdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysr
    akqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlv
    rgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlve
    iikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptar
    ltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippharh
    

  • Chain 'B':
    No sequence available.