PDB entry 4nks

View 4nks on RCSB PDB site
Description: Crystal structure of human fibroblast growth factor receptor 1 kinase domain in complex with pyrazolaminopyrimidine 3
Class: Transferase/transferase inhibitor
Keywords: KINASE, ATP BINDING, PHOSPHORYLATION, TRANS-MEMBRANE, Transferase-transferase inhibitor complex
Deposited on 2013-11-13, released 2013-12-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4nksa_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (31)
    Domains in SCOPe 2.03: d4nksb_
  • Heterogens: 2M2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nksA (A:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nksA (A:)
    lpedprwelprdrlvlgkplgqvvlaeainrvtkvavkmlkdatekdlsdlisememmkm
    igkhkniinllgactqdgplyviveyaskgnlreylqarrppqlsskdlvscayqvargm
    eylaskkcihrdlaarnvlvtednvmkiadfglidyykkttngrlpvkwmapealfdriy
    thqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcw
    havpsqrptfkqlvedldrivalts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nksB (B:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nksB (B:)
    seyelpedprwelprdrlvlgkplgegagqvvlaeaiglpnrvtkvavkmlksdatekdl
    sdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlsskdlv
    scayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgladyykkgrlpvkwmape
    alfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnely
    mmmrdcwhavpsqrptfkqlvedldrivalt