PDB entry 4nki

View 4nki on RCSB PDB site
Description: Crystal structure of a Fab
Class: cytokine
Keywords: nonoclonal antibody, immunoglobulin, antibody, PD-L1, Soluble protein, CYTOKINE
Deposited on 2013-11-12, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NKI (0-End)
  • Chain 'L':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NKI
    Domains in SCOPe 2.07: d4nkil1, d4nkil2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nkiL (L:)
    qsaltqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiydvsnrpsgv
    snrfsgsksgntasltisglqaedeadyycssytssstrvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nkiL (L:)
    saltqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiydvsnrpsgvs
    nrfsgsksgntasltisglqaedeadyycssytssstrvfgtgtkvtvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt