PDB entry 4nk9

View 4nk9 on RCSB PDB site
Description: Crystal structure of human fibroblast growth factor receptor 1 kinase domain in complex with pyrazolaminopyrimidine 1
Class: transferase/transferase inhibitor
Keywords: kinase, ATP binding, phosphorylation, trans-membrane, transferase-transferase inhibitor complex
Deposited on 2013-11-12, released 2013-12-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.209
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-308)
      • engineered mutation (31)
    Domains in SCOPe 2.03: d4nk9a_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-308)
      • engineered mutation (31)
    Domains in SCOPe 2.03: d4nk9b_
  • Heterogens: EDO, SO4, 2K5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nk9A (A:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nk9A (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaiglddkpnrvtkvavkmlksdatekd
    lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeqlss
    kdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgidyykkttngrlpv
    kwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsn
    ctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nk9B (B:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nk9B (B:)
    vseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkmlksdat
    ekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppql
    sskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgdyykkttngrlp
    vkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkps
    nctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe