PDB entry 4nja

View 4nja on RCSB PDB site
Description: Crystal structure of Fab 6C8 in complex with MPTS
Class: immune system
Keywords: immunoglobulin fold, MPTS binding, IMMUNE SYSTEM
Deposited on 2013-11-08, released 2014-11-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 6C8 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91Z05 (121-End)
      • conflict (145)
      • conflict (156)
    • PDB 4NJA (0-End)
  • Chain 'L':
    Compound: 6C8 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01660 (0-110)
      • conflict (99)
    • Uniprot Q7TS98 (111-End)
    Domains in SCOPe 2.06: d4njal1, d4njal2
  • Heterogens: ZN, ACT, 2M9, PO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4njaL (L:)
    divltqspaslavslgqratiscrasesvdsygnsfmhwyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltinpveaddvatyycqqsnedprtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4njaL (L:)
    divltqspaslavslgqratiscrasesvdsygnsfmhwyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltinpveaddvatyycqqsnedprtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne