PDB entry 4nj9

View 4nj9 on RCSB PDB site
Description: Crystal structure of Fab 8B10 in complex with MPTS
Class: immune system
Keywords: immunoglobulin fold, MPTS, IMMUNE SYSTEM
Deposited on 2013-11-08, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 8B10 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NJ9 (0-120)
    • Uniprot Q9D8L4 (121-220)
      • expression tag (221)
  • Chain 'L':
    Compound: 8B10 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NJ9 (0-110)
      • conflict (33)
      • conflict (79)
      • conflict (99)
    • Uniprot Q52L95 (111-End)
    Domains in SCOPe 2.07: d4nj9l1, d4nj9l2
  • Heterogens: ZN, 2M9, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nj9L (L:)
    divltqspaslavslgqratiscrasesvdsygisfmhwyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltiipveaddvatyycqqsnedprtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nj9L (L:)
    divltqspaslavslgqratiscrasesvdsygisfmhwyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltiipveaddvatyycqqsnedprtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceatspivksfnrne