PDB entry 4nhu

View 4nhu on RCSB PDB site
Description: The M33 TCR p3M33l/H-2 Ld Complex
Class: immune system
Keywords: Ig, TCR, MHC, antigen, immune system
Deposited on 2013-11-05, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2C m33 alpha VmCh chimera
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NHU
    Domains in SCOPe 2.06: d4nhua1, d4nhua2
  • Chain 'B':
    Compound: 2C m33 beta VmCh chimera
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NHU
    Domains in SCOPe 2.06: d4nhub1, d4nhub2
  • Chain 'C':
    Compound: 2C m33 alpha VmCh chimera
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NHU
    Domains in SCOPe 2.06: d4nhuc1, d4nhuc2
  • Chain 'D':
    Compound: 2C m33 beta VmCh chimera
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NHU
    Domains in SCOPe 2.06: d4nhud1, d4nhud2
  • Chain 'E':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (1-End)
      • engineered mutation (30)
      • engineered mutation (49)
      • engineered mutation (66)
      • engineered mutation (97)
      • engineered mutation (131)
      • engineered mutation (167)
      • linker (192-194)
      • see remark 999 (195-203)
  • Chain 'G':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (1-End)
      • engineered mutation (30)
      • engineered mutation (49)
      • engineered mutation (66)
      • engineered mutation (97)
      • engineered mutation (131)
      • engineered mutation (167)
      • linker (193-194)
      • see remark 999 (195-203)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nhuA (A:)
    adpgqsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvv
    qgvngfeaefsksnssfhlrkasvhwsdsavyfcavslhrpaltfgsgtkvivlpniqnp
    dpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
    snksdfacanafnnsiipedtffpspesssrgglevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhuA (A:)
    svtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvng
    feaefsksnssfhlrkasvhwsdsavyfcavslhrpaltfgsgtkvivlpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnsiipedtff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nhuB (B:)
    adpgeaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagste
    kgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    gradsrgglevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhuB (B:)
    aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlknvfppev
    avfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nhuC (C:)
    adpgqsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvv
    qgvngfeaefsksnssfhlrkasvhwsdsavyfcavslhrpaltfgsgtkvivlpniqnp
    dpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
    snksdfacanafnnsiipedtffpspesssrgglevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhuC (C:)
    svtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvng
    feaefsksnssfhlrkasvhwsdsavyfcavslhrpaltfgsgtkvivlpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nhuD (D:)
    adpgeaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagste
    kgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    gradsrgglevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhuD (D:)
    aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlknvfppev
    avfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    No sequence available.