PDB entry 4nh7

View 4nh7 on RCSB PDB site
Description: Correlation between chemotype-dependent binding conformations of HSP90 alpha/beta and isoform selectivity
Class: chaperone
Keywords: a/b fold, chaperone
Deposited on 2013-11-04, released 2014-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nh7a_
  • Chain 'B':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nh7b_
  • Heterogens: E0G, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nh7A (A:)
    gslhmdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryes
    ltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealq
    agadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrg
    tkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nh7A (A:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsfigypitlfvek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nh7B (B:)
    gslhmdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryes
    ltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealq
    agadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrg
    tkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nh7B (B:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealadismigqfgvgfy
    saylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqteyle
    errikeivkkhsqfigypitlfvek