PDB entry 4nf7

View 4nf7 on RCSB PDB site
Description: Crystal structure of the GH5 family catalytic domain of Endo-1,4-beta-glucanase Cel5C from Butyrivibrio proteoclasticus.
Class: hydrolase
Keywords: alpha/beta TIM barrel, Glycosyl hydrolase, Polysaccharide binding, Secreted, HYDROLASE
Deposited on 2013-10-30, released 2014-11-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-glucanase Cel5C
    Species: Butyrivibrio proteoclasticus [TaxId:515622]
    Gene: bpr_I1710, cel5C
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0RXM0 (2-362)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d4nf7a1, d4nf7a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nf7A (A:)
    gagtdrsatqvvsdmrvgwnignsldsfgqsynfpytslnetywgnpattkalidevaka
    gfntiripvswgqytsgsdyqipdfvmnrvkevvdycivndmyvilnshhdinsdycfyv
    pnnankdrsekyfksiwtqiakefrnydyhlvfetmneprlvghgeewwfprnnpsndir
    eavacindynqvaldairatggnnatrcvmvpgydasiegcmtdgfkmpndtasgrlils
    vhayipyyfalasdtyvtrfddnlkydidsffndlnskflsrnipvvvgetsatnrnnta
    ervkwadyywgraarysnvamvlwdnniyqnnsagsdgechmyidrnslqwkdpeiisti
    mkh