PDB entry 4nem

View 4nem on RCSB PDB site
Description: Small molecular fragment bound to crystal contact interface of Interleukin-2
Class: immune system
Keywords: fragment mapping, crystal contact, cytokine, Interleukin-2, helixbundle, CD25, extracellular, IMMUNE SYSTEM
Deposited on 2013-10-29, released 2014-11-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.209
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4nema_
  • Heterogens: 2JY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nemA (A:)
    ssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeel
    kpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwit
    fsqsiistlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nemA (A:)
    stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
    leevlnlaqdlisninvivlelkfmceyadetativeflnrwitfsqsiistlt