PDB entry 4ndm

View 4ndm on RCSB PDB site
Description: Structure of the AB18.1 TCR
Class: immune system
Keywords: Immunoglobulin, Histocompatibility antigens, T cell receptor, Immunological, lymphocytes, T cell recognition, activation, gamma delta T cell, Human, intraepithelial lymphocytes, CD1d, glycolipids, non-classical MHC, Glycoproteins, Cell-surface receptors, Immune system
Deposited on 2013-10-27, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell gamma protein,T-cell receptor beta-2 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: TRBC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NUW5 (Start-117)
      • conflict (103-104)
    • Uniprot A0A0G2JNG9 (118-246)
      • engineered mutation (174)
      • engineered mutation (192)
      • expression tag (247)
    Domains in SCOPe 2.07: d4ndma1, d4ndma2, d4ndma3
  • Chain 'B':
    Compound: human nkt tcr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PJ56 (11-130)
      • conflict (105-107)
      • conflict (109-114)
      • linker (131)
    • Uniprot K7N5M3 (132-End)
    Domains in SCOPe 2.07: d4ndmb1, d4ndmb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ndmA (A:)
    adpssnleggtksvtrptrssaeitcdltvinafyihwylhqegkapqrllyydvsnskd
    vlesglspgkyythtprrwswililrnliendsgvyycatwdrnnkklfgsgttlvvted
    lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
    lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
    aeawgradsrgglevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ndmA (A:)
    tksvtrptrssaeitcdltvinafyihwylhqegkapqrllyydvsnskdvlesglspgk
    yythtprrwswililrnliendsgvyycatwdrnnkklfgsgttlvvtedlknvfppeva
    vfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnds
    ryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ndmB (B:)
    adlsqqgeedpaqkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemifli
    rqgsdeqnaksgrysvnfkkaaksvaltisalqledsakyfcalgdqilywglshtdkli
    fgkgtrvtvepniqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcv
    ldmrsmdfksnsavawsnksdfacanafnnsiipedtffpspesssrgglevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ndmB (B:)
    aqkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqnaks
    grysvnfkkaaksvaltisalqledsakyfcalgdqilywglshtdklifgkgtrvtvep
    niqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpspe