PDB entry 4nda

View 4nda on RCSB PDB site
Description: Crystal structure of 3-nitro-tyrosine tRNA synthetase (5B) bound to 3-nitro-tyrosine
Class: ligase
Keywords: Rosmann Fold, 3-nitro-tyrosine amino-acyl tRNA synthetase, tRNA, LIGASE
Deposited on 2013-10-25, released 2014-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ0389, tyrS, tyrS MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-305)
      • engineered mutation (31)
      • engineered mutation (69)
      • engineered mutation (157-158)
      • engineered mutation (161)
      • expression tag (306-307)
    Domains in SCOPe 2.07: d4ndaa1, d4ndaa2
  • Heterogens: NIY, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ndaA (A:)
    mdefemikrntseiiseeelrevlkkdeksahigfepsgkihlghylqikkmidlqnagf
    diiilladlcaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnsahyrgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ndaA (A:)
    mdefemikrntseiiseeelrevlkkdeksahigfepsgkihlghylqikkmidlqnagf
    diiilladlcaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnsahyrgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrlle