PDB entry 4ncc

View 4ncc on RCSB PDB site
Description: Neutralizing antibody to murine norovirus
Class: immune system
Keywords: Immunoglobin, antibody, murine norovirus, IMMUNE SYSTEM
Deposited on 2013-10-24, released 2014-02-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.207
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Fab fragment light
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4NCC (0-End)
    Domains in SCOPe 2.05: d4ncc11, d4ncc12
  • Chain '2':
    Compound: Fab fragment heavy
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4NCC (Start-220)
  • Chain 'H':
    Compound: Fab fragment heavy
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4NCC (Start-220)
  • Chain 'L':
    Compound: Fab fragment light
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4NCC (0-210)
    Domains in SCOPe 2.05: d4nccl1, d4nccl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >4ncc1 (1:)
    qivltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrssypftfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ncc1 (1:)
    qivltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrssypftfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr
    

  • Chain '2':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nccL (L:)
    qivltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrssypftfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrn